Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) contains a common phosphate-binding site |
Family c.24.1.3: Inosicase [63971] (1 protein) |
Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [102255] (3 PDB entries) |
Domain d1pl0b1: 1pl0 B:4-200 [94848] Other proteins in same PDB: d1pl0a2, d1pl0b2, d1pl0c2, d1pl0d2 complexed with amz, bw2, k, xmp |
PDB Entry: 1pl0 (more details), 2.6 Å
SCOPe Domain Sequences for d1pl0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pl0b1 c.24.1.3 (B:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Human (Homo sapiens) [TaxId: 9606]} gqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdvseltgfpemlgg rvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktvaspgvtveeaveq idiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletrrqlalkafthta qydeaisdyfrkqyskg
Timeline for d1pl0b1: