Lineage for d1pkxb2 (1pkx B:201-592)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166092Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2166093Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2166260Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (1 protein)
    duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs
  6. 2166261Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species)
  7. 2166283Species Human (Homo sapiens) [TaxId:9606] [102716] (3 PDB entries)
  8. 2166285Domain d1pkxb2: 1pkx B:201-592 [94841]
    Other proteins in same PDB: d1pkxa1, d1pkxb1, d1pkxc1, d1pkxd1
    complexed with k, xmp

Details for d1pkxb2

PDB Entry: 1pkx (more details), 1.9 Å

PDB Description: Crystal Structure of human ATIC in complex with XMP
PDB Compounds: (B:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d1pkxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkxb2 c.97.1.4 (B:201-592) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Human (Homo sapiens) [TaxId: 9606]}
vsqmplrygmnphqtpaqlytlqpklpitvlngapgfinlcdalnawqlvkelkealgip
aaasfkhvspagaavgiplsedeakvcmvydlyktltpisaayarargadrmssfgdfva
lsdvcdvptakiisrevsdgiiapgyeeealtilskkkngnycvlqmdqsykpdenevrt
lfglhlsqkrnngvvdkslfsnvvtknkdlpesalrdlivatiavkytqsnsvcyakngq
vigigagqqsrihctrlagdkanywwlrhhpqvlsmkfktgvkraeisnaidqyvtgtig
ededlikwkalfeevpellteaekkewvekltevsissdaffpfrdnvdrakrsgvayia
apsgsaadkvvieacdelgiilahtnlrlfhh

SCOPe Domain Coordinates for d1pkxb2:

Click to download the PDB-style file with coordinates for d1pkxb2.
(The format of our PDB-style files is described here.)

Timeline for d1pkxb2: