![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.4: dUTPase-like [51283] (1 family) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
![]() | Family b.85.4.1: dUTPase-like [51284] (4 proteins) |
![]() | Protein Bifunctional dCTP deaminase/dUTPase [89425] (1 species) elaborated fold with additional structures |
![]() | Species Archaeon Methanococcus jannaschii [TaxId:2190] [89426] (4 PDB entries) synonym: Methanocaldococcus jannaschii |
![]() | Domain d1pkka_: 1pkk A: [94836] |
PDB Entry: 1pkk (more details), 1.77 Å
SCOP Domain Sequences for d1pkka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkka_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii [TaxId: 2190]} milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser kt
Timeline for d1pkka_: