SCOP 1.67: Domain d1pkjb_: 1pkj B:

Lineage for d1pkjb_ (1pkj B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (2 proteins)

6. Protein Bifunctional dCTP deaminase/dUTPase [89425] (1 species)
   elaborated fold with additional structures

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [89426] (4 PDB entries)
   synonym: Methanocaldococcus jannaschii

8. Domain d1pkjb_: 1pkj B: [94835]
   complexed with dut, egl

Details for d1pkjb_

PDB Entry: 1pkj, 2.1 Å

PDB Description: Structural basis for recognition and catalysis by the bifunctional dCTP deaminase and dUTPase from Methanococcus jannaschii

SCOP Domain Sequences for d1pkjb_:

Sequence; same for both SEQRES and ATOM records:

>d1pkjb_ b.85.4.1 (B:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii}
milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadv

Timeline for d1pkjb_:

• d1pkjb_ is new in SCOP 1.67
  
• d1pkjb_ appears in SCOP 1.69
  
• d1pkjb_ appears in the current release, SCOPe 2.08