Lineage for d1pkha_ (1pkh A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568126Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 568241Superfamily b.85.4: dUTPase-like [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 568242Family b.85.4.1: dUTPase-like [51284] (3 proteins)
  6. 568243Protein Bifunctional dCTP deaminase/dUTPase [89425] (1 species)
    elaborated fold with additional structures
  7. 568244Species Archaeon Methanococcus jannaschii [TaxId:2190] [89426] (4 PDB entries)
    synonym: Methanocaldococcus jannaschii
  8. 568245Domain d1pkha_: 1pkh A: [94832]

Details for d1pkha_

PDB Entry: 1pkh (more details), 1.42 Å

PDB Description: structural basis for recognition and catalysis by the bifunctional dctp deaminase and dutpase from methanococcus jannaschii

SCOP Domain Sequences for d1pkha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkha_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii}
milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser
kt

SCOP Domain Coordinates for d1pkha_:

Click to download the PDB-style file with coordinates for d1pkha_.
(The format of our PDB-style files is described here.)

Timeline for d1pkha_: