Lineage for d1pkgb_ (1pkg B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218391Protein c-KIT receptor [103296] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2218392Species Human (Homo sapiens) [TaxId:9606] [103297] (5 PDB entries)
    Uniprot P10721 547-935
  8. 2218399Domain d1pkgb_: 1pkg B: [94831]
    complexed with adp, mg

Details for d1pkgb_

PDB Entry: 1pkg (more details), 2.9 Å

PDB Description: structure of a c-kit kinase product complex
PDB Compounds: (B:) c-kit protein

SCOPe Domain Sequences for d1pkgb_:

Sequence, based on SEQRES records: (download)

>d1pkgb_ d.144.1.7 (B:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]}
nnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvavkml
kpsahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflrrk
rdsficsktspaimeddelaldledllsfsyqvakgmaflaskncihrdlaarnillthg
ritkicdfglardikndsnyvvkgnarlpvkwmapesifncvytfesdvwsygiflwelf
slgsspypgmpvdskfykmikegfrmlspehapaemydimktcwdadplkrptfkqivql
iekqis

Sequence, based on observed residues (ATOM records): (download)

>d1pkgb_ d.144.1.7 (B:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]}
nnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvavkml
kpsahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflrrk
rdsficldledllsfsyqvakgmaflaskncihrdlaarnillthgritkicdfglardr
lpvkwmapesifncvytfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrml
spehapaemydimktcwdadplkrptfkqivqliekqis

SCOPe Domain Coordinates for d1pkgb_:

Click to download the PDB-style file with coordinates for d1pkgb_.
(The format of our PDB-style files is described here.)

Timeline for d1pkgb_: