Lineage for d1pkfa_ (1pkf A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. Protein Cytochrome P450epok [101369] (1 species)
  7. Species Sorangium cellulosum [TaxId:56] [101370] (3 PDB entries)
  8. Domain d1pkfa_: 1pkf A: [94829]
    complexed with epd, hem

Details for d1pkfa_

PDB Entry: 1pkf (more details), 2.1 Å

PDB Description: crystal structure of epothilone d-bound cytochrome p450epok
PDB Compounds: (A:) cytochrome p450EpoK

SCOPe Domain Sequences for d1pkfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkfa_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]}
afdfkpfapgyaedpfpaierlreatpifywdegrswvltryhdvsavfrderfavsree
wessaeyssaipelsdmkkyglfglppedharvrklvnpsftsraidllraeiqrtvdql
ldarsgqeefdvvrdyaegipmraisallkvpaecdekfrrfgsataralgvglvprvde
etktlvasvteglallhgvlderrrnplendvltmllqaeadgsrlstkelvalvgaiia
agtdttiyliafavlnllrspealelvkaepglmrnaldevlrfenilrigtvrfarqdl
eycgasikkgemvfllipsalrdgtvfsrpdvfdvrrdtsaslaygrgphvcpgvslarl
eaeiavgtifrrfpemklketpvfgyhpafrnieslnvilkps

SCOPe Domain Coordinates for d1pkfa_ are not available.

Timeline for d1pkfa_: