Lineage for d1pk8g1 (1pk8 G:112-213)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470351Family c.30.1.5: Synapsin domain [52463] (2 proteins)
    automatically mapped to Pfam PF02078
  6. 2470352Protein Synapsin I [52464] (2 species)
  7. 2470358Species Norway rat (Rattus norvegicus) [TaxId:10116] [102287] (2 PDB entries)
  8. 2470365Domain d1pk8g1: 1pk8 G:112-213 [94819]
    Other proteins in same PDB: d1pk8a2, d1pk8b2, d1pk8c2, d1pk8d2, d1pk8e2, d1pk8f2, d1pk8g2, d1pk8h2
    complexed with atp, ca, edo

Details for d1pk8g1

PDB Entry: 1pk8 (more details), 2.1 Å

PDB Description: Crystal Structure of Rat Synapsin I C Domain Complexed to Ca.ATP
PDB Compounds: (G:) rat synapsin I

SCOPe Domain Sequences for d1pk8g1:

Sequence, based on SEQRES records: (download)

>d1pk8g1 c.30.1.5 (G:112-213) Synapsin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsv

Sequence, based on observed residues (ATOM records): (download)

>d1pk8g1 c.30.1.5 (G:112-213) Synapsin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevrslk
pdfvlirqhafsmarngdyrslviglqyagipsv

SCOPe Domain Coordinates for d1pk8g1:

Click to download the PDB-style file with coordinates for d1pk8g1.
(The format of our PDB-style files is described here.)

Timeline for d1pk8g1: