SCOP 1.67: Domain d1pk8f2: 1pk8 F:214-417

Lineage for d1pk8f2 (1pk8 F:214-417)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families)

5. Family d.142.1.3: Synapsin C-terminal domain [56078] (2 proteins)

6. Protein Synapsin [56079] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [103285] (2 PDB entries)

8. Domain d1pk8f2: 1pk8 F:214-417 [94818]
   Other proteins in same PDB: d1pk8a1, d1pk8b1, d1pk8c1, d1pk8d1, d1pk8e1, d1pk8f1, d1pk8g1, d1pk8h1

Details for d1pk8f2

PDB Entry: 1pk8, 2.1 Å

PDB Description: Crystal Structure of Rat Synapsin I C Domain Complexed to Ca.ATP

SCOP Domain Sequences for d1pk8f2:

Sequence, based on SEQRES records:

>d1pk8f2 d.142.1.3 (F:214-417) Synapsin {Rat (Rattus norvegicus)}
nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtsvsg
nwktntgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmp
ligdhqdedkqlivelvvnkmtqa

Sequence, based on observed residues (ATOM records):

>d1pk8f2 d.142.1.3 (F:214-417) Synapsin {Rat (Rattus norvegicus)}
nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtwktl
eqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkq
livelvvnkmtqa

Timeline for d1pk8f2:

• d1pk8f2 is new in SCOP 1.67
  
• d1pk8f2 appears in SCOP 1.69
  
• d1pk8f2 appears in the current release, SCOPe 2.08