Lineage for d1pk8b2 (1pk8 B:214-417)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978740Family d.142.1.3: Synapsin C-terminal domain [56078] (3 proteins)
    automatically mapped to Pfam PF02750
  6. 2978741Protein Synapsin [56079] (2 species)
  7. 2978747Species Norway rat (Rattus norvegicus) [TaxId:10116] [103285] (2 PDB entries)
  8. 2978749Domain d1pk8b2: 1pk8 B:214-417 [94810]
    Other proteins in same PDB: d1pk8a1, d1pk8b1, d1pk8c1, d1pk8d1, d1pk8e1, d1pk8f1, d1pk8g1, d1pk8h1
    complexed with atp, ca, edo

Details for d1pk8b2

PDB Entry: 1pk8 (more details), 2.1 Å

PDB Description: Crystal Structure of Rat Synapsin I C Domain Complexed to Ca.ATP
PDB Compounds: (B:) rat synapsin I

SCOPe Domain Sequences for d1pk8b2:

Sequence, based on SEQRES records: (download)

>d1pk8b2 d.142.1.3 (B:214-417) Synapsin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtsvsg
nwktntgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmp
ligdhqdedkqlivelvvnkmtqa

Sequence, based on observed residues (ATOM records): (download)

>d1pk8b2 d.142.1.3 (B:214-417) Synapsin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtwktn
tgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdh
qdedkqlivelvvnkmtqa

SCOPe Domain Coordinates for d1pk8b2:

Click to download the PDB-style file with coordinates for d1pk8b2.
(The format of our PDB-style files is described here.)

Timeline for d1pk8b2: