SCOP 1.69: Domain d1pk7a_: 1pk7 A:

Lineage for d1pk7a_ (1pk7 A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (7 species)

7. Species Escherichia coli [TaxId:562] [53172] (19 PDB entries)

8. Domain d1pk7a_: 1pk7 A: [94804]

Details for d1pk7a_

PDB Entry: 1pk7, 2.5 Å

PDB Description: crystal structure of e. coli purine nucleoside phosphorylase complexed with adenosine and sulfate/phosphate

SCOP Domain Sequences for d1pk7a_:

Sequence; same for both SEQRES and ATOM records:

>d1pk7a_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Escherichia coli}
atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk

Timeline for d1pk7a_:

• d1pk7a_ first appeared in SCOP 1.67
  
• d1pk7a_ appears in SCOP 1.71
  
• d1pk7a_ appears in the current release, SCOPe 2.08