Lineage for d1pk6c_ (1pk6 C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048772Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2048773Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2048774Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2048838Protein Complement c1q globular head, C chain [101617] (1 species)
    hetrotrimer of A, B and C chains
  7. 2048839Species Human (Homo sapiens) [TaxId:9606] [101618] (5 PDB entries)
  8. 2048842Domain d1pk6c_: 1pk6 C: [94803]
    Other proteins in same PDB: d1pk6a_, d1pk6b_
    complexed with ca

Details for d1pk6c_

PDB Entry: 1pk6 (more details), 1.85 Å

PDB Description: globular head of the complement system protein c1q
PDB Compounds: (C:) Complement C1q subcomponent, C chain precursor

SCOPe Domain Sequences for d1pk6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pk6c_ b.22.1.1 (C:) Complement c1q globular head, C chain {Human (Homo sapiens) [TaxId: 9606]}
kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
fsgfllfpd

SCOPe Domain Coordinates for d1pk6c_:

Click to download the PDB-style file with coordinates for d1pk6c_.
(The format of our PDB-style files is described here.)

Timeline for d1pk6c_: