SCOP 1.69: Domain d1pk6c_: 1pk6 C:

Lineage for d1pk6c_ (1pk6 C:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (1 family)

5. Family b.22.1.1: TNF-like [49843] (11 proteins)

6. Protein Complement c1q globular head, C chain [101617] (1 species)
   hetrotrimer of A, B and C chains

7. Species Human (Homo sapiens) [TaxId:9606] [101618] (1 PDB entry)

8. Domain d1pk6c_: 1pk6 C: [94803]
   Other proteins in same PDB: d1pk6a_, d1pk6b_

Details for d1pk6c_

PDB Entry: 1pk6, 1.85 Å

PDB Description: globular head of the complement system protein c1q

SCOP Domain Sequences for d1pk6c_:

Sequence; same for both SEQRES and ATOM records:

>d1pk6c_ b.22.1.1 (C:) Complement c1q globular head, C chain {Human (Homo sapiens)}
kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
fsgfllfpd

Timeline for d1pk6c_:

• d1pk6c_ first appeared in SCOP 1.67
  
• d1pk6c_ appears in SCOP 1.71
  
• d1pk6c_ appears in the current release, SCOPe 2.08