Class b: All beta proteins [48724] (141 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (1 family) |
Family b.22.1.1: TNF-like [49843] (11 proteins) |
Protein Complement c1q globular head, C chain [101617] (1 species) hetrotrimer of A, B and C chains |
Species Human (Homo sapiens) [TaxId:9606] [101618] (1 PDB entry) |
Domain d1pk6c_: 1pk6 C: [94803] Other proteins in same PDB: d1pk6a_, d1pk6b_ complexed with ca |
PDB Entry: 1pk6 (more details), 1.85 Å
SCOP Domain Sequences for d1pk6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk6c_ b.22.1.1 (C:) Complement c1q globular head, C chain {Human (Homo sapiens)} kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv fsgfllfpd
Timeline for d1pk6c_: