![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein Complement c1q globular head, B chain [101615] (1 species) hetrotrimer of A, B and C chains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101616] (3 PDB entries) |
![]() | Domain d1pk6b_: 1pk6 B: [94802] Other proteins in same PDB: d1pk6a_, d1pk6c_ complexed with ca |
PDB Entry: 1pk6 (more details), 1.85 Å
SCOPe Domain Sequences for d1pk6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk6b_ b.22.1.1 (B:) Complement c1q globular head, B chain {Human (Homo sapiens) [TaxId: 9606]} tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega nsifsgfllfpd
Timeline for d1pk6b_: