Lineage for d1pk6b_ (1pk6 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306419Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1306420Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1306421Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1306478Protein Complement c1q globular head, B chain [101615] (1 species)
    hetrotrimer of A, B and C chains
  7. 1306479Species Human (Homo sapiens) [TaxId:9606] [101616] (3 PDB entries)
  8. 1306480Domain d1pk6b_: 1pk6 B: [94802]
    Other proteins in same PDB: d1pk6a_, d1pk6c_
    complexed with ca

Details for d1pk6b_

PDB Entry: 1pk6 (more details), 1.85 Å

PDB Description: globular head of the complement system protein c1q
PDB Compounds: (B:) Complement C1q subcomponent, B chain precursor

SCOPe Domain Sequences for d1pk6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pk6b_ b.22.1.1 (B:) Complement c1q globular head, B chain {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpd

SCOPe Domain Coordinates for d1pk6b_:

Click to download the PDB-style file with coordinates for d1pk6b_.
(The format of our PDB-style files is described here.)

Timeline for d1pk6b_: