SCOPe 2.02: Domain d1pk6b_: 1pk6 B:

Lineage for d1pk6b_ (1pk6 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Complement c1q globular head, B chain [101615] (1 species)
   hetrotrimer of A, B and C chains

7. Species Human (Homo sapiens) [TaxId:9606] [101616] (3 PDB entries)

8. Domain d1pk6b_: 1pk6 B: [94802]
   Other proteins in same PDB: d1pk6a_, d1pk6c_
   complexed with ca

Details for d1pk6b_

PDB Entry: 1pk6, 1.85 Å

PDB Description: globular head of the complement system protein c1q

PDB Compounds: (B:) Complement C1q subcomponent, B chain precursor

SCOPe Domain Sequences for d1pk6b_:

Sequence; same for both SEQRES and ATOM records:

>d1pk6b_ b.22.1.1 (B:) Complement c1q globular head, B chain {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpd

Timeline for d1pk6b_:

• d1pk6b_ first appeared in SCOP 1.67
  
• d1pk6b_ appears in SCOPe 2.01
  
• d1pk6b_ appears in SCOPe 2.03
  
• d1pk6b_ appears in the current release, SCOPe 2.08