Lineage for d1pk6b_ (1pk6 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370769Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 370770Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 370771Family b.22.1.1: TNF-like [49843] (11 proteins)
  6. 370807Protein Complement c1q globular head, B chain [101615] (1 species)
    hetrotrimer of A, B and C chains
  7. 370808Species Human (Homo sapiens) [TaxId:9606] [101616] (1 PDB entry)
  8. 370809Domain d1pk6b_: 1pk6 B: [94802]
    Other proteins in same PDB: d1pk6a_, d1pk6c_
    complexed with ca

Details for d1pk6b_

PDB Entry: 1pk6 (more details), 1.85 Å

PDB Description: globular head of the complement system protein c1q

SCOP Domain Sequences for d1pk6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pk6b_ b.22.1.1 (B:) Complement c1q globular head, B chain {Human (Homo sapiens)}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpd

SCOP Domain Coordinates for d1pk6b_:

Click to download the PDB-style file with coordinates for d1pk6b_.
(The format of our PDB-style files is described here.)

Timeline for d1pk6b_: