Class b: All beta proteins [48724] (176 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein Complement c1q globular head, A chain [101613] (1 species) hetrotrimer of A, B and C chains |
Species Human (Homo sapiens) [TaxId:9606] [101614] (5 PDB entries) |
Domain d1pk6a_: 1pk6 A: [94801] Other proteins in same PDB: d1pk6b_, d1pk6c_ complexed with ca |
PDB Entry: 1pk6 (more details), 1.85 Å
SCOPe Domain Sequences for d1pk6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk6a_ b.22.1.1 (A:) Complement c1q globular head, A chain {Human (Homo sapiens) [TaxId: 9606]} qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse adsvfsgflifps
Timeline for d1pk6a_: