Lineage for d1pk6a_ (1pk6 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943163Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 943164Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 943165Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 943211Protein Complement c1q globular head, A chain [101613] (1 species)
    hetrotrimer of A, B and C chains
  7. 943212Species Human (Homo sapiens) [TaxId:9606] [101614] (3 PDB entries)
  8. 943213Domain d1pk6a_: 1pk6 A: [94801]
    Other proteins in same PDB: d1pk6b_, d1pk6c_
    complexed with ca

Details for d1pk6a_

PDB Entry: 1pk6 (more details), 1.85 Å

PDB Description: globular head of the complement system protein c1q
PDB Compounds: (A:) Complement C1q subcomponent, A chain precursor

SCOPe Domain Sequences for d1pk6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pk6a_ b.22.1.1 (A:) Complement c1q globular head, A chain {Human (Homo sapiens) [TaxId: 9606]}
qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
adsvfsgflifps

SCOPe Domain Coordinates for d1pk6a_:

Click to download the PDB-style file with coordinates for d1pk6a_.
(The format of our PDB-style files is described here.)

Timeline for d1pk6a_: