Class a: All alpha proteins [46456] (202 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (10 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (21 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [47517] (10 PDB entries) |
Domain d1pk0e_: 1pk0 E: [94799] Other proteins in same PDB: d1pk0a_, d1pk0b_, d1pk0c_ |
PDB Entry: 1pk0 (more details), 3.3 Å
SCOP Domain Sequences for d1pk0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk0e_ a.39.1.5 (E:) Calmodulin {Human (Homo sapiens)} teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid fpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdem ireadidgdgqvnyeefvqmmta
Timeline for d1pk0e_: