Lineage for d1pk0b_ (1pk0 B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574537Fold e.41: Adenylylcyclase toxin (the edema factor) [81299] (1 superfamily)
    3 domains: (1&2) alpha+beta, with domain 2 being inserted in domain 1; (3) all-alpha
  4. 2574538Superfamily e.41.1: Adenylylcyclase toxin (the edema factor) [81298] (1 family) (S)
    Domain 1 has topological and active site similarity to the Nucleotidyltransferases (eg. 1kny N-domain); domain 3 binds calmodulin
  5. 2574539Family e.41.1.1: Adenylylcyclase toxin (the edema factor) [69887] (1 protein)
    decorated with many insertions and the C-terminal domain
  6. 2574540Protein Adenylylcyclase toxin (the edema factor) [69888] (1 species)
  7. 2574541Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69889] (7 PDB entries)
    Uniprot P40136
  8. 2574553Domain d1pk0b_: 1pk0 B: [94796]
    Other proteins in same PDB: d1pk0d_, d1pk0e_, d1pk0f_
    complexed with ca, ema, yb

Details for d1pk0b_

PDB Entry: 1pk0 (more details), 3.3 Å

PDB Description: Crystal Structure of the EF3-CaM complexed with PMEApp
PDB Compounds: (B:) calmodulin-sensitive adenylate cyclase

SCOPe Domain Sequences for d1pk0b_:

Sequence, based on SEQRES records: (download)

>d1pk0b_ e.41.1.1 (B:) Adenylylcyclase toxin (the edema factor) {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
dvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvhgk
ssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlrieel
kengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfnwrn
ievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvtnll
ikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdnei
fiinpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitkak
intiptsaefiknlssirrssnvgvykdsgdkdefakkesvkkiagylsdyynsanhifs
qekkrkisifrgiqayneienvlkskqiapeyknyfqylkeritnqvqlllthqksnief
kllykqlnftenetdnfevfqkiid

Sequence, based on observed residues (ATOM records): (download)

>d1pk0b_ e.41.1.1 (B:) Adenylylcyclase toxin (the edema factor) {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
dvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvhgk
ssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlrieel
kengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfnwrn
ievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnekqkgvtnllik
ygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdneifi
inpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitkakin
tiptsaefsvkkiagylsdyynsanhifsqekkrkisifrgiqayneienvlkskqiape
yknyfqylkeritnqvqlllthqkfkllykqlnftenetdnfevfqkiid

SCOPe Domain Coordinates for d1pk0b_:

Click to download the PDB-style file with coordinates for d1pk0b_.
(The format of our PDB-style files is described here.)

Timeline for d1pk0b_: