Lineage for d1pjwa_ (1pjw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765451Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2765452Protein Envelope glycoprotein [49213] (5 species)
  7. 2765473Species Japanese encephalitis virus [TaxId:11072] [101527] (1 PDB entry)
  8. 2765474Domain d1pjwa_: 1pjw A: [94793]
    C-terminal domain only

Details for d1pjwa_

PDB Entry: 1pjw (more details)

PDB Description: solution structure of the domain iii of the japan encephalitis virus envelope protein
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d1pjwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjwa_ b.1.18.4 (A:) Envelope glycoprotein {Japanese encephalitis virus [TaxId: 11072]}
dklalkgttygmctekfsfaknpadtghgtvvielsysgsdgpckipivsvaslndmtpv
grlvtvnpfvatssanskvlvemeppfgdsyivvgmgdkqinhhwhkagst

SCOPe Domain Coordinates for d1pjwa_:

Click to download the PDB-style file with coordinates for d1pjwa_.
(The format of our PDB-style files is described here.)

Timeline for d1pjwa_: