Class g: Small proteins [56992] (72 folds) |
Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily) disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III |
Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family) |
Family g.69.1.1: Plant proteinase inhibitors [57486] (3 proteins) |
Protein Wound-induced proteinase inhibitor-II [90168] (1 species) two-domain inhibitor; consists of one continuous domain of canonical fold and one discontinuous, circularly-permutated domain |
Species Tomato (Lycopersicon esculentum) [TaxId:4081] [90169] (2 PDB entries) |
Domain d1pjua2: 1pju A:2-15,A:75-116 [94785] |
PDB Entry: 1pju (more details), 2.15 Å
SCOP Domain Sequences for d1pjua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjua2 g.69.1.1 (A:2-15,A:75-116) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum)} actrecgnlgfgicXrsqgksliyptgcttcctgykgcyyfgkdgkfvcegesdepk
Timeline for d1pjua2: