Lineage for d1pjua2 (1pju A:2-15,A:75-116)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430959Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily)
    disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III
  4. 430960Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family) (S)
  5. 430961Family g.69.1.1: Plant proteinase inhibitors [57486] (3 proteins)
  6. 430972Protein Wound-induced proteinase inhibitor-II [90168] (1 species)
    two-domain inhibitor; consists of one continuous domain of canonical fold and one discontinuous, circularly-permutated domain
  7. 430973Species Tomato (Lycopersicon esculentum) [TaxId:4081] [90169] (2 PDB entries)
  8. 430975Domain d1pjua2: 1pju A:2-15,A:75-116 [94785]

Details for d1pjua2

PDB Entry: 1pju (more details), 2.15 Å

PDB Description: Unbound form of Tomato Inhibitor-II

SCOP Domain Sequences for d1pjua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjua2 g.69.1.1 (A:2-15,A:75-116) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum)}
actrecgnlgfgicXrsqgksliyptgcttcctgykgcyyfgkdgkfvcegesdepk

SCOP Domain Coordinates for d1pjua2:

Click to download the PDB-style file with coordinates for d1pjua2.
(The format of our PDB-style files is described here.)

Timeline for d1pjua2: