Lineage for d1pjtb3 (1pjt B:114-215)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020180Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily)
    2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix
  4. 3020181Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (2 families) (S)
  5. 3020182Family e.37.1.1: Siroheme synthase middle domains-like [75616] (2 proteins)
  6. 3020188Protein Siroheme synthase CysG, domains 2 and 3 [103403] (2 species)
  7. 3020192Species Salmonella typhimurium [TaxId:90371] [103404] (5 PDB entries)
  8. 3020202Domain d1pjtb3: 1pjt B:114-215 [94783]
    Other proteins in same PDB: d1pjta1, d1pjta2, d1pjtb1, d1pjtb2
    complexed with po4, sah; mutant

Details for d1pjtb3

PDB Entry: 1pjt (more details), 2.8 Å

PDB Description: the structure of the ser128ala point-mutant variant of cysg, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis
PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d1pjtb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjtb3 e.37.1.1 (B:114-215) Siroheme synthase CysG, domains 2 and 3 {Salmonella typhimurium [TaxId: 90371]}
psiidrsplmvavsaggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg
errrfwekffvndrlaqslanadekavnatterlfsepldhr

SCOPe Domain Coordinates for d1pjtb3:

Click to download the PDB-style file with coordinates for d1pjtb3.
(The format of our PDB-style files is described here.)

Timeline for d1pjtb3: