SCOPe 2.01: Domain d1pjtb2: 1pjt B:216-457

Lineage for d1pjtb2 (1pjt B:216-457)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
   Pfam PF00590

6. Protein Siroheme synthase CysG, domains 4 and 5 [102682] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [102683] (3 PDB entries)

8. Domain d1pjtb2: 1pjt B:216-457 [94782]
   Other proteins in same PDB: d1pjta1, d1pjta3, d1pjtb1, d1pjtb3
   complexed with po4, sah; mutant

Details for d1pjtb2

PDB Entry: 1pjt, 2.8 Å

PDB Description: the structure of the ser128ala point-mutant variant of cysg, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis

PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d1pjtb2:

Sequence, based on SEQRES records:

>d1pjtb2 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli
afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs
nh

Sequence, based on observed residues (ATOM records):

>d1pjtb2 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkrahcv
pqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcs
aysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekliaf
gmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh

Timeline for d1pjtb2:

• d1pjtb2 first appeared in SCOP 1.67
  
• d1pjtb2 appears in SCOP 1.75
  
• d1pjtb2 appears in SCOPe 2.02
  
• d1pjtb2 appears in the current release, SCOPe 2.08