Lineage for d1pjtb1 (1pjt B:1-113)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454110Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins)
  6. 2454116Protein Siroheme synthase CysG, domain 1 [102163] (2 species)
  7. 2454120Species Salmonella typhimurium [TaxId:90371] [102164] (5 PDB entries)
  8. 2454130Domain d1pjtb1: 1pjt B:1-113 [94781]
    Other proteins in same PDB: d1pjta2, d1pjta3, d1pjtb2, d1pjtb3
    complexed with po4, sah; mutant

Details for d1pjtb1

PDB Entry: 1pjt (more details), 2.8 Å

PDB Description: the structure of the ser128ala point-mutant variant of cysg, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis
PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d1pjtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjtb1 c.2.1.11 (B:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]}
mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim

SCOPe Domain Coordinates for d1pjtb1:

Click to download the PDB-style file with coordinates for d1pjtb1.
(The format of our PDB-style files is described here.)

Timeline for d1pjtb1: