Lineage for d1pjta3 (1pjt A:114-215)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 518888Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily)
    2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix
  4. 518889Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (1 family) (S)
  5. 518890Family e.37.1.1: Siroheme synthase middle domains-like [75616] (2 proteins)
  6. 518896Protein Siroheme synthase CysG, domains 2 and 3 [103403] (1 species)
  7. 518897Species Salmonella typhimurium [TaxId:90371] [103404] (3 PDB entries)
  8. 518900Domain d1pjta3: 1pjt A:114-215 [94780]
    Other proteins in same PDB: d1pjta1, d1pjta2, d1pjtb1, d1pjtb2

Details for d1pjta3

PDB Entry: 1pjt (more details), 2.8 Å

PDB Description: the structure of the ser128ala point-mutant variant of cysg, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis

SCOP Domain Sequences for d1pjta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjta3 e.37.1.1 (A:114-215) Siroheme synthase CysG, domains 2 and 3 {Salmonella typhimurium}
psiidrsplmvavsaggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg
errrfwekffvndrlaqslanadekavnatterlfsepldhr

SCOP Domain Coordinates for d1pjta3:

Click to download the PDB-style file with coordinates for d1pjta3.
(The format of our PDB-style files is described here.)

Timeline for d1pjta3: