Lineage for d1pjsb2 (1pjs B:216-457)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160460Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2160461Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2160462Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2160642Protein Siroheme synthase CysG, domains 4 and 5 [102682] (1 species)
  7. 2160643Species Salmonella typhimurium [TaxId:90371] [102683] (3 PDB entries)
  8. 2160647Domain d1pjsb2: 1pjs B:216-457 [94776]
    Other proteins in same PDB: d1pjsa1, d1pjsa3, d1pjsb1, d1pjsb3
    complexed with nad, pge, po4, sah

Details for d1pjsb2

PDB Entry: 1pjs (more details), 2.4 Å

PDB Description: The co-crystal structure of CysG, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis, in complex with it NAD cofactor
PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d1pjsb2:

Sequence, based on SEQRES records: (download)

>d1pjsb2 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli
afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs
nh

Sequence, based on observed residues (ATOM records): (download)

>d1pjsb2 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghggeldwenlaaekqtlvfymglnqaatiqekliafg
mqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh

SCOPe Domain Coordinates for d1pjsb2:

Click to download the PDB-style file with coordinates for d1pjsb2.
(The format of our PDB-style files is described here.)

Timeline for d1pjsb2: