SCOP 1.71: Domain d1pjsb1: 1pjs B:1-113

Lineage for d1pjsb1 (1pjs B:1-113)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins)

6. Protein Siroheme synthase CysG, domain 1 [102163] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [102164] (3 PDB entries)

8. Domain d1pjsb1: 1pjs B:1-113 [94775]
   Other proteins in same PDB: d1pjsa2, d1pjsa3, d1pjsb2, d1pjsb3
   complexed with nad, pge, po4, sah

Details for d1pjsb1

PDB Entry: 1pjs, 2.4 Å

PDB Description: The co-crystal structure of CysG, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis, in complex with it NAD cofactor

SCOP Domain Sequences for d1pjsb1:

Sequence; same for both SEQRES and ATOM records:

>d1pjsb1 c.2.1.11 (B:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium}
mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim

Timeline for d1pjsb1:

• d1pjsb1 first appeared in SCOP 1.67
  
• d1pjsb1 appears in SCOP 1.69
  
• d1pjsb1 appears in SCOP 1.73
  
• d1pjsb1 appears in the current release, SCOPe 2.08