![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) ![]() |
![]() | Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins) |
![]() | Protein Siroheme synthase CysG, domain 1 [102163] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [102164] (3 PDB entries) |
![]() | Domain d1pjsb1: 1pjs B:1-113 [94775] Other proteins in same PDB: d1pjsa2, d1pjsa3, d1pjsb2, d1pjsb3 complexed with nad, pge, po4, sah |
PDB Entry: 1pjs (more details), 2.4 Å
SCOP Domain Sequences for d1pjsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjsb1 c.2.1.11 (B:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium} mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim
Timeline for d1pjsb1: