Lineage for d1pjsb1 (1pjs B:1-113)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388798Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins)
  6. 388804Protein Siroheme synthase CysG, domain 1 [102163] (1 species)
  7. 388805Species Salmonella typhimurium [TaxId:90371] [102164] (3 PDB entries)
  8. 388811Domain d1pjsb1: 1pjs B:1-113 [94775]
    Other proteins in same PDB: d1pjsa2, d1pjsa3, d1pjsb2, d1pjsb3
    complexed with nad, pge, po4, sah

Details for d1pjsb1

PDB Entry: 1pjs (more details), 2.4 Å

PDB Description: The co-crystal structure of CysG, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis, in complex with it NAD cofactor

SCOP Domain Sequences for d1pjsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjsb1 c.2.1.11 (B:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium}
mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim

SCOP Domain Coordinates for d1pjsb1:

Click to download the PDB-style file with coordinates for d1pjsb1.
(The format of our PDB-style files is described here.)

Timeline for d1pjsb1: