Lineage for d1pjsa3 (1pjs A:114-215)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 619171Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily)
    2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix
  4. 619172Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (1 family) (S)
  5. 619173Family e.37.1.1: Siroheme synthase middle domains-like [75616] (2 proteins)
  6. 619179Protein Siroheme synthase CysG, domains 2 and 3 [103403] (1 species)
  7. 619180Species Salmonella typhimurium [TaxId:90371] [103404] (3 PDB entries)
  8. 619185Domain d1pjsa3: 1pjs A:114-215 [94774]
    Other proteins in same PDB: d1pjsa1, d1pjsa2, d1pjsb1, d1pjsb2

Details for d1pjsa3

PDB Entry: 1pjs (more details), 2.4 Å

PDB Description: The co-crystal structure of CysG, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis, in complex with it NAD cofactor

SCOP Domain Sequences for d1pjsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjsa3 e.37.1.1 (A:114-215) Siroheme synthase CysG, domains 2 and 3 {Salmonella typhimurium}
psiidrsplmvavssggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg
errrfwekffvndrlaqslanadekavnatterlfsepldhr

SCOP Domain Coordinates for d1pjsa3:

Click to download the PDB-style file with coordinates for d1pjsa3.
(The format of our PDB-style files is described here.)

Timeline for d1pjsa3: