![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
![]() | Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family) ![]() |
![]() | Family c.90.1.1: Tetrapyrrole methylase [53791] (4 proteins) Pfam 00590 |
![]() | Protein Siroheme synthase CysG, domains 4 and 5 [102682] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [102683] (3 PDB entries) |
![]() | Domain d1pjqb2: 1pjq B:216-457 [94770] Other proteins in same PDB: d1pjqa1, d1pjqa3, d1pjqb1, d1pjqb3 complexed with act, pge, sah |
PDB Entry: 1pjq (more details), 2.21 Å
SCOP Domain Sequences for d1pjqb2:
Sequence, based on SEQRES records: (download)
>d1pjqb2 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium} gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs nh
>d1pjqb2 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium} gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkrahcv pqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcs aysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekliaf gmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh
Timeline for d1pjqb2: