Lineage for d1pjqb2 (1pjq B:216-457)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 592992Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 592993Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family) (S)
  5. 592994Family c.90.1.1: Tetrapyrrole methylase [53791] (4 proteins)
    Pfam 00590
  6. 593005Protein Siroheme synthase CysG, domains 4 and 5 [102682] (1 species)
  7. 593006Species Salmonella typhimurium [TaxId:90371] [102683] (3 PDB entries)
  8. 593008Domain d1pjqb2: 1pjq B:216-457 [94770]
    Other proteins in same PDB: d1pjqa1, d1pjqa3, d1pjqb1, d1pjqb3
    complexed with act, pge, sah

Details for d1pjqb2

PDB Entry: 1pjq (more details), 2.21 Å

PDB Description: Structure and function of CysG, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis

SCOP Domain Sequences for d1pjqb2:

Sequence, based on SEQRES records: (download)

>d1pjqb2 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli
afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs
nh

Sequence, based on observed residues (ATOM records): (download)

>d1pjqb2 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkrahcv
pqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcs
aysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekliaf
gmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh

SCOP Domain Coordinates for d1pjqb2:

Click to download the PDB-style file with coordinates for d1pjqb2.
(The format of our PDB-style files is described here.)

Timeline for d1pjqb2: