![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins) |
![]() | Protein Siroheme synthase CysG, domain 1 [102163] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [102164] (3 PDB entries) |
![]() | Domain d1pjqa1: 1pjq A:1-113 [94766] Other proteins in same PDB: d1pjqa2, d1pjqa3, d1pjqb2, d1pjqb3 |
PDB Entry: 1pjq (more details), 2.21 Å
SCOP Domain Sequences for d1pjqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium} mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim
Timeline for d1pjqa1: