SCOPe 2.06: Domain d1pjaa_: 1pja A:

Lineage for d1pjaa_ (1pja A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.13: Thioesterases [53542] (4 proteins)

6. Protein Palmitoyl protein thioesterase 2 [102629] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102630] (1 PDB entry)

8. Domain d1pjaa_: 1pja A: [94758]
   complexed with gol, nag

Details for d1pjaa_

PDB Entry: 1pja, 2.7 Å

PDB Description: the crystal structure of palmitoyl protein thioesterase-2 reveals the basis for divergent substrate specificities of the two lysosomal thioesterases (ppt1 and ppt2)

PDB Compounds: (A:) Palmitoyl-protein thioesterase 2 precursor

SCOPe Domain Sequences for d1pjaa_:

Sequence; same for both SEQRES and ATOM records:

>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]}
sykpvivvhglfdssysfrhlleyinethpgtvvtvldlfdgreslrplweqvqgfreav
vpimakapqgvhlicysqgglvcrallsvmddhnvdsfislsspqmgqygdtdylkwlfp
tsmrsnlyricyspwgqefsicnywhdphhddlylnassflalingerdhpnatvwrknf
lrvghlvliggpddgvitpwqssffgfydanetvlemeeqlvylrdsfglktllargaiv
rcpmagishtawhsnrtlyetciepwls

Timeline for d1pjaa_:

• d1pjaa_ first appeared in SCOP 1.67
  
• d1pjaa_ appears in SCOPe 2.05
  
• d1pjaa_ appears in SCOPe 2.07
  
• d1pjaa_ appears in the current release, SCOPe 2.08