Lineage for d1pjaa_ (1pja A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 400671Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 400672Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 401000Family c.69.1.13: Thioesterases [53542] (3 proteins)
  6. 401010Protein Palmitoyl protein thioesterase 2 [102629] (1 species)
  7. 401011Species Human (Homo sapiens) [TaxId:9606] [102630] (1 PDB entry)
  8. 401012Domain d1pjaa_: 1pja A: [94758]
    complexed with gol, nag

Details for d1pjaa_

PDB Entry: 1pja (more details), 2.7 Å

PDB Description: the crystal structure of palmitoyl protein thioesterase-2 reveals the basis for divergent substrate specificities of the two lysosomal thioesterases (ppt1 and ppt2)

SCOP Domain Sequences for d1pjaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens)}
sykpvivvhglfdssysfrhlleyinethpgtvvtvldlfdgreslrplweqvqgfreav
vpimakapqgvhlicysqgglvcrallsvmddhnvdsfislsspqmgqygdtdylkwlfp
tsmrsnlyricyspwgqefsicnywhdphhddlylnassflalingerdhpnatvwrknf
lrvghlvliggpddgvitpwqssffgfydanetvlemeeqlvylrdsfglktllargaiv
rcpmagishtawhsnrtlyetciepwls

SCOP Domain Coordinates for d1pjaa_:

Click to download the PDB-style file with coordinates for d1pjaa_.
(The format of our PDB-style files is described here.)

Timeline for d1pjaa_: