Lineage for d1pj7a2 (1pj7 A:4-219,A:339-427)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1351449Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1351450Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1351504Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 1351691Protein N,N-dimethylglycine oxidase [102181] (1 species)
  7. 1351692Species Arthrobacter globiformis [TaxId:1665] [102182] (3 PDB entries)
  8. 1351695Domain d1pj7a2: 1pj7 A:4-219,A:339-427 [94751]
    Other proteins in same PDB: d1pj7a1, d1pj7a3, d1pj7a4
    complexed with fad, ffo, na

Details for d1pj7a2

PDB Entry: 1pj7 (more details), 2.1 Å

PDB Description: structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid
PDB Compounds: (A:) N,N-dimethylglycine oxidase

SCOPe Domain Sequences for d1pj7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj7a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]}
tpriviigagivgtnladelvtrgwnnitvldqgplnmpggstshapglvfqtnpsktma
sfakytvekllsltedgvscfnqvgglevattetrladlkrklgyaaawgiegrllspae
cqelyplldgenilgglhvpsdglasaaravqllikrtesagvtyrgsttvtgieqsggr
vtgvqtadgvipadivvscagfwgakigamigmavpXpdggpllgeskeldgfyvaeavw
vthsagvakamaellttgrsetdlgecditrfedvqltpeyvsetsqqnfveiydvlhpl
qprlsp

SCOPe Domain Coordinates for d1pj7a2:

Click to download the PDB-style file with coordinates for d1pj7a2.
(The format of our PDB-style files is described here.)

Timeline for d1pj7a2: