Lineage for d1pj6a3 (1pj6 A:220-338)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408639Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 408640Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 408786Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)
  6. 408838Protein N,N-dimethylglycine oxidase [102802] (1 species)
  7. 408839Species Arthrobacter globiformis [TaxId:1665] [102803] (3 PDB entries)
  8. 408841Domain d1pj6a3: 1pj6 A:220-338 [94748]
    Other proteins in same PDB: d1pj6a1, d1pj6a2, d1pj6a4
    complexed with fad, fol, na

Details for d1pj6a3

PDB Entry: 1pj6 (more details), 1.65 Å

PDB Description: Crystal structure of dimethylglycine oxidase of Arthrobacter globiformis in complex with folic acid

SCOP Domain Sequences for d1pj6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj6a3 d.16.1.5 (A:220-338) N,N-dimethylglycine oxidase {Arthrobacter globiformis}
llplahqyvkttpvpaqqgrndqpngarlpilrhqdqdlyyrehgdrygigsyahrpmpv
dvdtlgayapetvsehhmpsrldftledflpaweatkqllpaladseiedgfngifsft

SCOP Domain Coordinates for d1pj6a3:

Click to download the PDB-style file with coordinates for d1pj6a3.
(The format of our PDB-style files is described here.)

Timeline for d1pj6a3: