Lineage for d1pj6a2 (1pj6 A:3-219,A:339-427)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 388822Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 388823Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 388877Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (13 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 388967Protein N,N-dimethylglycine oxidase [102181] (1 species)
  7. 388968Species Arthrobacter globiformis [TaxId:1665] [102182] (3 PDB entries)
  8. 388970Domain d1pj6a2: 1pj6 A:3-219,A:339-427 [94747]
    Other proteins in same PDB: d1pj6a1, d1pj6a3, d1pj6a4
    complexed with fad, fol, na

Details for d1pj6a2

PDB Entry: 1pj6 (more details), 1.65 Å

PDB Description: Crystal structure of dimethylglycine oxidase of Arthrobacter globiformis in complex with folic acid

SCOP Domain Sequences for d1pj6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj6a2 c.3.1.2 (A:3-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis}
stpriviigagivgtnladelvtrgwnnitvldqgplnmpggstshapglvfqtnpsktm
asfakytvekllsltedgvscfnqvgglevattetrladlkrklgyaaawgiegrllspa
ecqelyplldgenilgglhvpsdglasaaravqllikrtesagvtyrgsttvtgieqsgg
rvtgvqtadgvipadivvscagfwgakigamigmavpXpdggpllgeskeldgfyvaeav
wvthsagvakamaellttgrsetdlgecditrfedvqltpeyvsetsqqnfveiydvlhp
lqprlsp

SCOP Domain Coordinates for d1pj6a2:

Click to download the PDB-style file with coordinates for d1pj6a2.
(The format of our PDB-style files is described here.)

Timeline for d1pj6a2: