SCOPe 2.06: Domain d1pj6a1: 1pj6 A:743-830

Lineage for d1pj6a1 (1pj6 A:743-830)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families)

5. Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)

6. Protein N,N-dimethylglycine oxidase, C-terminal domain [101792] (1 species)

7. Species Arthrobacter globiformis [TaxId:1665] [101793] (3 PDB entries)

8. Domain d1pj6a1: 1pj6 A:743-830 [94746]
   Other proteins in same PDB: d1pj6a2, d1pj6a3, d1pj6a4
   complexed with fad, fol, na

Details for d1pj6a1

PDB Entry: 1pj6, 1.65 Å

PDB Description: Crystal structure of dimethylglycine oxidase of Arthrobacter globiformis in complex with folic acid

PDB Compounds: (A:) N,N-dimethylglycine oxidase

SCOPe Domain Sequences for d1pj6a1:

Sequence; same for both SEQRES and ATOM records:

>d1pj6a1 b.44.2.1 (A:743-830) N,N-dimethylglycine oxidase, C-terminal domain {Arthrobacter globiformis [TaxId: 1665]}
arrlrcltiddgrsivlgkepvfykeqavgyvtsaaygytvakpiaysylpgtvsvgdsv
dieyfgrritatvtedplydpkmtrlrg

Timeline for d1pj6a1:

• d1pj6a1 first appeared in SCOP 1.67
  
• d1pj6a1 appears in SCOPe 2.05
  
• d1pj6a1 appears in SCOPe 2.07
  
• d1pj6a1 appears in the current release, SCOPe 2.08