Lineage for d1pj5a4 (1pj5 A:428-742)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1946403Fold d.250: Folate-binding domain [103024] (1 superfamily)
    duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands
  4. 1946404Superfamily d.250.1: Folate-binding domain [103025] (2 families) (S)
    some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase
  5. 1946405Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins)
  6. 1946424Protein N,N-dimethylglycine oxidase domain 3 [103027] (1 species)
  7. 1946425Species Arthrobacter globiformis [TaxId:1665] [103028] (3 PDB entries)
  8. 1946426Domain d1pj5a4: 1pj5 A:428-742 [94745]
    Other proteins in same PDB: d1pj5a1, d1pj5a2, d1pj5a3
    complexed with act, fad, na

Details for d1pj5a4

PDB Entry: 1pj5 (more details), 1.61 Å

PDB Description: Crystal structure of dimethylglycine oxidase of Arthrobacter globiformis in complex with acetate
PDB Compounds: (A:) N,N-dimethylglycine oxidase

SCOPe Domain Sequences for d1pj5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj5a4 d.250.1.1 (A:428-742) N,N-dimethylglycine oxidase domain 3 {Arthrobacter globiformis [TaxId: 1665]}
rnlrvspfharhkelgaffleaggwerpywfeanaallkempaewlppardawsgmfssp
iaaaeawktrtavamydmtplkrlevsgpgalkllqelttadlakkpgavtytllldhag
gvrsditvarlsedtfqlgangnidtayferaarhqtqsgsatdwvqvrdttggtccigl
wgplardlvskvsdddftndglkyfraknvviggipvtamrlsyvgelgwelytsadngq
rlwdalwqagqpfgviaagraafsslrlekgyrswgtdmttehdpfeaglgfavkmakes
figkgalegrteeas

SCOPe Domain Coordinates for d1pj5a4:

Click to download the PDB-style file with coordinates for d1pj5a4.
(The format of our PDB-style files is described here.)

Timeline for d1pj5a4: