Lineage for d1pj5a4 (1pj5 A:428-742)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516715Fold d.250: Aminomethyltransferase folate-binding domain [103024] (1 superfamily)
    duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands
  4. 516716Superfamily d.250.1: Aminomethyltransferase folate-binding domain [103025] (1 family) (S)
    some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase
  5. 516717Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (3 proteins)
  6. 516730Protein N,N-dimethylglycine oxidase domain 3 [103027] (1 species)
  7. 516731Species Arthrobacter globiformis [TaxId:1665] [103028] (3 PDB entries)
  8. 516732Domain d1pj5a4: 1pj5 A:428-742 [94745]
    Other proteins in same PDB: d1pj5a1, d1pj5a2, d1pj5a3

Details for d1pj5a4

PDB Entry: 1pj5 (more details), 1.61 Å

PDB Description: Crystal structure of dimethylglycine oxidase of Arthrobacter globiformis in complex with acetate

SCOP Domain Sequences for d1pj5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj5a4 d.250.1.1 (A:428-742) N,N-dimethylglycine oxidase domain 3 {Arthrobacter globiformis}
rnlrvspfharhkelgaffleaggwerpywfeanaallkempaewlppardawsgmfssp
iaaaeawktrtavamydmtplkrlevsgpgalkllqelttadlakkpgavtytllldhag
gvrsditvarlsedtfqlgangnidtayferaarhqtqsgsatdwvqvrdttggtccigl
wgplardlvskvsdddftndglkyfraknvviggipvtamrlsyvgelgwelytsadngq
rlwdalwqagqpfgviaagraafsslrlekgyrswgtdmttehdpfeaglgfavkmakes
figkgalegrteeas

SCOP Domain Coordinates for d1pj5a4:

Click to download the PDB-style file with coordinates for d1pj5a4.
(The format of our PDB-style files is described here.)

Timeline for d1pj5a4: