Lineage for d1pj5a1 (1pj5 A:743-830)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561274Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 561350Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (1 family) (S)
  5. 561351Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)
  6. 561367Protein N,N-dimethylglycine oxidase, C-terminal domain [101792] (1 species)
  7. 561368Species Arthrobacter globiformis [TaxId:1665] [101793] (3 PDB entries)
  8. 561369Domain d1pj5a1: 1pj5 A:743-830 [94742]
    Other proteins in same PDB: d1pj5a2, d1pj5a3, d1pj5a4
    complexed with act, fad, na

Details for d1pj5a1

PDB Entry: 1pj5 (more details), 1.61 Å

PDB Description: Crystal structure of dimethylglycine oxidase of Arthrobacter globiformis in complex with acetate

SCOP Domain Sequences for d1pj5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj5a1 b.44.2.1 (A:743-830) N,N-dimethylglycine oxidase, C-terminal domain {Arthrobacter globiformis}
arrlrcltiddgrsivlgkepvfykeqavgyvtsaaygytvakpiaysylpgtvsvgdsv
dieyfgrritatvtedplydpkmtrlrg

SCOP Domain Coordinates for d1pj5a1:

Click to download the PDB-style file with coordinates for d1pj5a1.
(The format of our PDB-style files is described here.)

Timeline for d1pj5a1: