SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1pj4c1 (1pj4 C:2280-2573)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2093723Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 protein domains)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2093883Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
    includes C-terminal additional subdomains
  7. 2093901Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)
  8. 2093920Domain d1pj4c1: 1pj4 C:2280-2573 [94738]
    Other proteins in same PDB: d1pj4a2, d1pj4b2, d1pj4c2, d1pj4d2
    complexed with atp, fum, mlt, mn

Details for d1pj4c1

PDB Entry: 1pj4 (more details), 2.3 Å

PDB Description: Crystal structure of human mitochondrial NAD(P)+-dependent malic enzyme in a pentary complex with natural substrate malate, ATP, Mn++, and allosteric activator fumarate.
PDB Compounds: (C:) NAD-dependent malic enzyme, mitochondrial

SCOPe Domain Sequences for d1pj4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj4c1 c.2.1.7 (C:2280-2573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

SCOPe Domain Coordinates for d1pj4c1:

Click to download the PDB-style file with coordinates for d1pj4c1.
(The format of our PDB-style files is described here.)

Timeline for d1pj4c1: