SCOPe 2.05: Domain d1pj3d1: 1pj3 D:3280-3573

Lineage for d1pj3d1 (1pj3 D:3280-3573)

Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
includes C-terminal additional subdomains
Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)
Domain d1pj3d1: 1pj3 D:3280-3573 [94732]
Other proteins in same PDB: d1pj3a2, d1pj3b2, d1pj3c2, d1pj3d2
complexed with fum, mn, nad, pyr

Details for d1pj3d1

PDB Entry: 1pj3 (more details), 2.1 Å

PDB Description: Crystal structure of human mitochondrial NAD(P)+-dependent malic enzyme in a pentary complex with natural substrate pyruvate, cofactor NAD+, Mn++, and allosteric activator fumarate.

PDB Compounds: (D:) NAD-dependent malic enzyme, mitochondrial

SCOPe Domain Sequences for d1pj3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj3d1 c.2.1.7 (D:3280-3573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

SCOPe Domain Coordinates for d1pj3d1:

Click to download the PDB-style file with coordinates for d1pj3d1.
(The format of our PDB-style files is described here.)

Timeline for d1pj3d1: