SCOP 1.71: Domain d1pj3d1: 1pj3 D:3280-3573

Lineage for d1pj3d1 (1pj3 D:3280-3573)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
   includes C-terminal additional subdomains

7. Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)

8. Domain d1pj3d1: 1pj3 D:3280-3573 [94732]
   Other proteins in same PDB: d1pj3a2, d1pj3b2, d1pj3c2, d1pj3d2
   complexed with fum, mn, nad, pyr

Details for d1pj3d1

PDB Entry: 1pj3, 2.1 Å

PDB Description: Crystal structure of human mitochondrial NAD(P)+-dependent malic enzyme in a pentary complex with natural substrate pyruvate, cofactor NAD+, Mn++, and allosteric activator fumarate.

SCOP Domain Sequences for d1pj3d1:

Sequence; same for both SEQRES and ATOM records:

>d1pj3d1 c.2.1.7 (D:3280-3573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens)}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

Timeline for d1pj3d1:

• d1pj3d1 first appeared in SCOP 1.67
  
• d1pj3d1 appears in SCOP 1.69
  
• d1pj3d1 appears in SCOP 1.73
  
• d1pj3d1 appears in the current release, SCOPe 2.08