Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species) includes C-terminal additional subdomains |
Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries) |
Domain d1pj2d1: 1pj2 D:3280-3573 [94724] Other proteins in same PDB: d1pj2a2, d1pj2b2, d1pj2c2, d1pj2d2 complexed with fum, mlt, mn, nai |
PDB Entry: 1pj2 (more details), 2.3 Å
SCOP Domain Sequences for d1pj2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pj2d1 c.2.1.7 (D:3280-3573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens)} iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp
Timeline for d1pj2d1: