SCOP 1.67: Domain d1pj2c2: 1pj2 C:2021-2279

Lineage for d1pj2c2 (1pj2 C:2021-2279)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.3: Mitochondrial NAD(P)-dependent malic enzyme [53240] (1 protein)
   this domain is decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)

8. Domain d1pj2c2: 1pj2 C:2021-2279 [94723]
   Other proteins in same PDB: d1pj2a1, d1pj2b1, d1pj2c1, d1pj2d1

Details for d1pj2c2

PDB Entry: 1pj2, 2.3 Å

PDB Description: crystal structure of human mitochondrial nad(p)+-dependent malic enzyme in a pentary complex with natural substrate malate, cofactor nadh, mn++, and allosteric activator fumarate

SCOP Domain Sequences for d1pj2c2:

Sequence; same for both SEQRES and ATOM records:

>d1pj2c2 c.58.1.3 (C:2021-2279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens)}
ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
nafrflrkyrekyctfndd

Timeline for d1pj2c2:

• d1pj2c2 is new in SCOP 1.67
  
• d1pj2c2 appears in SCOP 1.69
  
• d1pj2c2 appears in the current release, SCOPe 2.08