SCOPe 2.07: Domain d1pj1b_: 1pj1 B:

Lineage for d1pj1b_ (1pj1 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (10 species)

7. Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)

8. Domain d1pj1b_: 1pj1 B: [94717]
   complexed with fe, hg

Details for d1pj1b_

PDB Entry: 1pj1, 1.95 Å

PDB Description: ribonucleotide reductase r2-d84e/w48f soaked with ferrous ions at ph 5

PDB Compounds: (B:) Ribonucleoside-diphosphate reductase 1 beta chain

SCOPe Domain Sequences for d1pj1b_:

Sequence; same for both SEQRES and ATOM records:

>d1pj1b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsfffrpeevdvsrdri
dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv

Timeline for d1pj1b_:

• d1pj1b_ first appeared in SCOP 1.67
  
• d1pj1b_ appears in SCOPe 2.06
  
• d1pj1b_ appears in the current release, SCOPe 2.08