Lineage for d1pj1a_ (1pj1 A:)
- Root: SCOP 1.67
Class a: All alpha proteins [46456] (202 folds) 
Fold a.25: Ferritin-like [47239] (2 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connectionSuperfamily a.25.1: Ferritin-like [47240] (3 families) 
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins) Protein Ribonucleotide reductase R2 [47257] (6 species) Species Escherichia coli [TaxId:562] [47258] (21 PDB entries) 
Domain d1pj1a_: 1pj1 A: [94716]
Details for d1pj1a_
PDB Entry: 1pj1 (more details), 1.95 Å
PDB Description: ribonucleotide reductase r2-d84e/w48f soaked with ferrous ions at ph 5
SCOP Domain Sequences for d1pj1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pj1a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsfffrpeevdvsrdri
dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv
SCOP Domain Coordinates for d1pj1a_:
Click to download the PDB-style file with coordinates for d1pj1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pj1a_:
- d1pj1a_ is new in SCOP 1.67
- d1pj1a_ appears in SCOP 1.69
- d1pj1a_ appears in the current release, SCOPe 2.08
View in 3D
